Dataset for protein Bik of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         . *.     .* **  . : ..::   :  * :*:. .:  . *... *  . ..
------------------------rtqGgvrhypsPtGRtpsptvpntiq--vylSlvGvwgpsqqvgRwgpgPqrspgs
metpecapvsgagktathetkqvcmpa areavnk r  lcpgspagafltpiqh al lreaapgac raac gfggap

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .:   ..**. .                          *****************************************
rslrssgsPRpeg--------------------------GEMSEVRPLSSDIFMETLLCEQFVDPLTMEVVGGSDPEEDL
apillrag  aadttplgwvadsaiiaataaaaaaaaar                                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
DPVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYEVAMYSPGLAFVLDRTDIGDVLSGVVDVFANFQEDIVRLW
                                                                                

       250       260       270      
....:....|....:....|....:....|....:.
************************************
RSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
                                    
© 1998-2020Legal notice