Dataset for protein Noxa of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50    
....:....|....:....|....:....|....:....|....:....|....
******************************************************
MPGRRARKSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
© 1998-2020Legal notice