Dataset for protein classical BH3-containing proteins of organism Bos indicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
makqpsdvs------------------------------secdre----qpaerppql--rpgaptslq-e---------
-----q---sleddvglardgprpfplsrlvpsavscgl------ggql--g---r--ls---------t-rqlsrlqlg
 mppr-hrgepqpvs                        fqpedgaapaet-tqa-syskadlfaqqqlgdcpgnpegef
 cec lcge e e e                        vratlpl rsp crl gasfcswwv pgvtaalghqqwppa
 fri efeq                              cp ga     m  q  akfa h tt hair  a ap g g 
  qa  e                                          c  l   g                       
                                                 a  d                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------drspapmpcdkstetpspscqaf-----a-a
prthqggpglrptsqespgtqttssasfifvrrssllsrsssgyfsfdtppqgvvssaevteqslrspagq-nhyls-m-
dlsrccstqgplappadkapfalrppl                      rspnsmla-sqhrlpqvlfypglgyr plp 
gscppr  rpd  av trsrhssyr g                      ggd tlc- gagl g-----a-a      l 
   lh                                            qe  e--   tev - g  r-rs        
                                                      rv   p   d      n         
                                                                      h         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         .  *. :.*.::                                           
s-----a--adtrpeqw-------iaqeLrrigDefnayypr----rvfvrhqrvegspqmvlyrvlryivrlvwrmq--
-mrqsq-vp----e-i-qhraarqtgaq qcma qlh-r---vprpsrrmqsyaqrrhrwwwtlll-l-nlaqpgglgaw
ggptqlppgvrpp-g-     eiey rr kals d  q-tmwlnliklqeerrqhppngmrpqiw-w-hlapfnadrnrp
 f aga l eqge nl      qrc ik      k  vlqkl     shatqttana--al---npimga-----aea n
         rsa                         fsfeg     kll ag ---p --trf- f c-sw sr--- g
                                                ag    m q  s         q     n    
                                                                                

       
....:..
       
-------
gvgprnl
llernq 
eaa s  
 s     
       
       
© 1998-2020Legal notice