Dataset for protein Puma of organism Bos indicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                         .   ** *.*. **.*:: :* .*  :            
---------------------------------------vrptlpAArAcPcqLPgAyl-sPwvPpqvt-----------
mararqegsspepveglardgprpfplsrlvpsavscglceagae  p a al  a ffca ta hairaalgaprwpgg

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           *********************************************************************
-----------GPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEER
prsrprgprpd                                                                     

       170       180       190   
....:....|....:....|....:....|...
*********************************
QRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
                                 
© 1998-2020Legal notice