Dataset for protein Bmf of organism Anas platyrhynchos platyrhynchos

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************..*  .  *  ..*:*..:*  :    *:  .***.::. :*. :.         
LSPSSSSQDVMLPCGVTEEPRRLFYgsAgyrssV-vvgFsLstqLqlkrqggQqphwAEVsitrllQctssq--------
                         an eqklh ppaa a dph geepgee eear   qfahkf aiadlfhrlhiqr

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *   *: *:              :::*::.::.:                                    * *  . . 
-QqnrNqvWw--------------qllLlvhnlgvn-----------------------------------VpApvtsvq
h gal kh fggetctppagcedseif flfkfallwtplccslpceagsscptlskesqnvgvfgkaccw e nrnhtg

      
....:.
:*    
qR----
e qvlg
© 1998-2020Legal notice