Dataset for protein classical BH3-containing proteins of organism Amphiprion ocellaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                          .: . :    *   :      *  *       . . .   :            :
maakftisdses-psevv-egkngprptfqcipsfd grmslpllpq nn rpplnveehprpslgv-ytrsi-r-prra
         mdd eddef  dehchda a afkcea cndaegealn ah m dcg a e qa     qgnag h hfp 

        90       100       110       120       130       140       150       160
    :      .  :           .    .        : *  : *:          :   .   .            
sfgliqnhqeeqqptppeqnkmlqlprqqqtprsmekkykhk qlis qadgggprlllklylkntysqeplrtmnlsn-
 d efg d  de emdgagfeaad aa p lpaaac   a  g        gehdh  h lq na iacqfhhck 

       170       180       190       200 
:           :.        .                  
  r aaatl c  dhg aa eg age fihp e        
© 1998-2020Legal notice