Dataset for protein Unclassified of organism Albatrosspox virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8E5AIQ4_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Albatrosspox virus (length=180 residues).
MDPSVKKDEIYYTILNIIQNYFIEYCTGKNRNFHVEDENTYIIVKNMCDIILRDNIVEFRKDIDRCSDIENEIPEIVYDT
IHDKITWGRVISIIAFGAYVTKVFKEKGRDNVVDLMPDIITESLLSRCRSWLSDQNCWDGLKAYVYNNKKFYYVTRYFRA
AAFIITSLAVINLFFVESHN
© 1998-2022Legal notice