Dataset for protein Unclassified of organism Macacine gammaherpesvirus 5

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A5J6XVA7_uncORF16-01 Putative ORF16 protein OS=[Viruses] Macacine gammaherpesvirus 5 (length=187 residues).
MAAVQGPPPPPEEENENSLPVDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFISAFLKDSARLYERLLRHTDYRSLRGLN
AIGQGMLQINTDGRHNWGRALAVLGLGAYVVDKVKDDERLLTFAIAVLPVYAYEALESQWFRSHGEWEGLRNYCERILRH
RRNARRHMCYGVAAGLLALVALFAIRR
© 1998-2020Legal notice