Dataset for protein BCL-2-like of organism Xenopus tropicalis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q5XGJ4_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL2L2 (length=188 residues).
MAQSELGSRALVEDFVRYKLCQRSLVPEPAGAASCSLHSAMRAAGDEFEERFRQAFSEISTQIHVTPGTAYARFAEVAGS
LFQGGVNWGRIVAFFVFGAALCAESVNKEMSPLLPRIQDWMVTYLETNLRDWIQSNGGWNGFLTLYGDGAIEEARRQREG
NWASLKTVLTGAVALGALMTVGALFASK
© 1998-2020Legal notice