Dataset for protein Bfl1 of organism Vombatus ursinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4X2KFL7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Vombatus ursinus GN=BCL2A1 (length=172 residues).
MADYEFHYVHMLAQDYLKYVQQMPQLGSCLNKTSQILQKVAFSVQGEVEKDMETCLSTLDIASVDSARRIFKSVMEKEFE
DGIINWGRIVTIFAFGGILIKKLLRHRSPLTMSTHEEVSYFIAEFIMNNIAEWIRQNGGWENGFVKNFEPNMVWPNFTDI
STKIWGVFSFLK
© 1998-2020Legal notice