Dataset for protein Bcl-w of organism Tarsius syrichta

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A1U7UJF2_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Tarsius syrichta GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A1U7UJF2_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Tarsius syrichta GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
© 1998-2020Legal notice