Dataset for protein Mcl-1 of organism Takifugu rubripes

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A674PI93_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Takifugu rubripes GN=MCL-1 (length=272 residues).
MNIIANHTALRIMNVVFQNGVVDGAGHSSPLIPMASRGSLSGNDSPKRPSKLSVIAPKVCVAKAIQEDSQDTDHRSAPCT
PEMNSVNGLDVSGRPAEDEAALDNDTRQLLSRFMADFCGIGSHQWRESGALSTMKRVVANLMEKHRYVYNGMTKQLTLDD
RGDDVSFVSSVAKSIFADGVTNWGRIASLVAFGAVVAQHMKDNGRRDCVEPVAQEISTYLLTDRRDWLIKNNGWEGFVEF
FQVSDPESSVRNMLMAVAGVAGLGATLALLIR
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice