Dataset for protein Bcl-xL of organism Strigops habroptila

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A672UKR0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Strigops habroptila GN=BCL2L1 (length=230 residues).
MSSSNRALVIDFVSYKLSQKGHSWSQLEEEDENRTDFAAEEVEMDGVLNGSPSWHPPASHVVNGAAVHRSSLQVHDMVQA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLV
GRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
© 1998-2020Legal notice