Dataset for protein Unclassified of organism Stichopus japonicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A5Q0TJ90_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Stichopus japonicus (length=219 residues).
MGIQQNSHDLITPKYATYESRRRRPFYCDNVFPRNIPLCAMLQGETNLDNMTENITGNFIEAYMVLKLADFGVDRPDRLG
LNIHAASSVGSEICPYHTTLYSTEKDAMVRAILVELDLLDTLTNLHISKHTLLETFLYIADTLFEDDDVSWWKIVTLVDC
SAQMAVMCVDRELPNMVESLLSWTSMIMEKDNVQSWIEENGGWKFLTNRMKSYLQTQAV
© 1998-2020Legal notice