Dataset for protein Mcl-1 of organism Sparus aurata

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A671VEU3_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata GN=MCL-1 (length=280 residues).
MFPKKAAITTGVMSYFQNGVVGGTMHYDSRDSAPEIAMSSSLDSQNGNVGSNDTPKRPINLGVNTAKAYNVPKNLREDSE
DLEDGSLPCTPELQSENDMDISSCPAGDELLDQDTRQLISRFLAVYTGLSKLRWKENKELSTMMRVVEGVLEKHRYAYNG
MVKKLTLDEREDASFVSSVAKSLFADGTTNWGRVVSLMAFGAVVSQYLKEKGRGHCVEQVGQEISTYLLTEQRDWLVKNN
SWDGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIR
>gnl|bcl2dbpro|A0A671VEU3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata GN=MCL-1 (length=297 residues).
MFPKKAAITTGVMSYFQNGVVGGTMHYDSRDSAPEIAMSSSLDSQNGNVGSNDTPKRPINLGVNTAKAYNVPKNLREDSE
DLEDGSLPCTPELQSENDMDISSCPAGDELLDQDTRQLISRFLAVYTGLSKLRWKENKELSTMMRVVEGVLEKHRYAYNG
MVKKLTLDEREDASFVSSVAKSLFADGTTNWGRVVSLMAFGAVVSQYLKEKGRGHCVEQVGQEISTYLLTEQRDWLVKNN
SWDGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLISPRVSRGEVHEMTSSSAE
>gnl|bcl2dbpro|A0A671VEU3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata GN=MCL-1 (length=289 residues).
MFPKKAAITTGVMSYFQNGVVGGTMHYDSRDSAPEIAMSSSLDSQNGNVGSNDTPKRPINLGVNTAKAYNVPKNLREDSE
DLEDGSLPCTPELQSENDMDISSCPAGDELLDQDTRQLISRFLAVYTGLSKLRWKENKELSTMMRVVEGVLEKHRYAYNG
MVKKLTLDEREDASFVSSVAKSLFADGTTNWGRVVSLMAFGAVVSQYLKEKGRGHCVEQVGQEISTYLLTEQRDWLVKNN
SWDGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIRCDLRLSRPE
© 1998-2020Legal notice