Dataset for protein Unclassified of organism Sinocyclocheilus grahami

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A672PR31_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus grahami (length=214 residues).
MRVEMAQENVYDNRSIVVKYIQHKLWKRGYVWDVDGHEDSVSNGLMMERREDRGISPSSRHDPCRALQRVLREAGDELER
LYQSDFAEMSKQLHLTSITAHQRFTAVIDELFRDGVNWGRIIAFFEFGGTVCVECVSKEMTAHVDNIAGWMTEYLNGPLH
GWIQENGGWEAFVELYSRQRDSVFRSSWSSIVTVFGLAALGAVGLTIGAYLAQK
>gnl|bcl2dbpro|A0A672RJN9_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus grahami (length=246 residues).
MANEIRYDNRNIVEKYLNHKLSKKGYEWKFQSSGEDDDTVNTGVEDSSPNSGRRLQAPSAGGGNNSECLIANRVTRSDSY
SRIYGALREAGDQIERMHQREFEEMSHQMIFSRNAEQRSFLAVAEELFRDEVNWGRIVAFFEFGGIMCVESFNREMASQV
DNIAHWMTDYLNGPLENWIEENGGWTFFPLHLFTVEYRNKGGGRHAHGRLPTYMVLIPGLEHLSGPVDSMAPHPQHIRLM
TRSLSF
>gnl|bcl2dbpro|A0A672RJN9_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus grahami (length=229 residues).
MANEIRYDNRNIVEKYLNHKLSKKGYEWKFQSSGEDDDTVNTGVEDSSPNSGRRLQAPSAGGGNNSECLIANRVTRSDSY
SRIYGALREAGDQIERMHQREFEEMSHQMIFSRNAEQRSFLAVAEELFRDEVNWGRIVAFFEFGGIMCVESFNREMASQV
DNIAHWMTDYLNGPLENWIEENGGWDAFVELYGQQRDSMFHPLSYLTKVLGLAALGLAGVTIGAFFAQK
>gnl|bcl2dbpro|A0A672S3K4_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus grahami (length=266 residues).
MCHFSELFSVRERFFRYDVLRITDFFLLALVLSRLITMATEIRFDNRNIVEKYINHKLSKKGYVWKSQSSGEDDDTVDKG
VEGSSLNSDRRLQAPSAGGGNNSECLIAHRVTRSDPYSRIYRALREAGDEIERIYQREFEEMSHRMIFSPNTTQRSFLAV
AEELFIDGVNWGRIVAFFEFGGTMCVESVNREMASQVDNIAHWMTDYLNGPLENWIEENGGWDAFVELYSQQRDSVFHPF
SYLTKVLGLAVLGLAGVTIGAFFAQK
© 1998-2020Legal notice