Dataset for protein Bcl-2 of organism Scleropages formosus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C9T5U7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Scleropages formosus GN=BCL-2 (length=244 residues).
MANEGAYDSRDIVEVYLYHKLLKTGYVWEFRAAAAADADPSNNGLTDSGSPGLPGSPGSQVVARRSQAAGAADAEDAPLS
RSRAPHCDPRCDHHAALHRVLREAGDEIERMYQRDFAQMPERLHFTPSTAQRKFTAVIEELFSDGVNWGRIVAFFEFGGT
MCVESVNREMTSQVDNIARWMTEYLNGPLRNWIQENGGWDAFVELYGQQRGSVFRCSWPYIKTVFGLAALGAAGVTIGAY
LTHK
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice