Dataset for protein Unclassified of organism Sarcophilus harrisii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A7N4P7A1_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sarcophilus harrisii (length=417 residues).
MEPPQIPRRRLDFGSSSDSGSSSDSGSSSDSGSSRDSGSSSDSGSSSDSGSSRDSGSSSDSGSSSDSGSSSDSGSSRDSG
SSSDSGTSSDSGSSSDSGTSSLRRTPLLPVPLLSPLLFPLLSPLLSPPNPSSRLPDRNCSNAASGESGRSPLEAGPSGSS
EPWTLCSPENELEALGGSRSAPPSTWQARPEPAAESLQCISRLVIGNYLLGRAYRFTHGRGHSCPGSWGPSPNGRAGSGR
GPEGSSGGPRGRRRPDLEPAPRGGPGSRPRLPSNASSRCRLPALCINTLKAVGGDLQLRHKGVFEDLMRRLAQQRRVWPR
TLVRITRDAFSGGPTNWGRVAAVLAFVRFVLRGVGLLEGASLLSDRISDTLVRAQEAWLRQQRGWRGLVRFFYGEDLEGF
LGNASGNWGFVCPLAYV
© 1998-2021Legal notice