Dataset for protein Bcl-2 of organism Sarcophilus harrisii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A7N4PQN7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL-2 (length=255 residues).
MAHPGRRGYDNREIVMKYIHYKLSQRGYEWDAGNLRTPASPSLPPVVASAPAVGIFSNQPRHTPLPAAPQDLATSTTAAA
RNSPLPPPPAVAAATVAAGPAVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNW
GRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWLSLKTLLSLA
LVGACITLGAYLGHK
© 1998-2022Legal notice