Dataset for protein Mcl-1 of organism Salarias fasciatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A672GRK8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salarias fasciatus GN=MCL-1 (length=303 residues).
MNIMSTNTKRAGLFGCLIFPQNGVMHYGSEDPTHQLPMGAGVDTLHGHVETPKRPKNLDVAAVNGYASKNLREDSEDVDD
GSLPCTPELHSDSEADVSYSAAGSEVLESDTRQLLSRYFSEFTGLSKTQRGESKPLSTMKRVVEDILAKHRYAYNGMINR
LSMEERGGDLRFLQSVARTLFSDGSTNWGRIASLVAFGAVVCQHMREQGRPDCVELVGQEISTYLLSEQRDWLIKNNSWD
GFVEFFHVADPESTVRNTLMAVAGFAGIGATLALLISCSGKGLKTSPRPKREEQAALVPVVQP
© 1998-2020Legal notice