Dataset for protein Bcl2l10 of organism Salarias fasciatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A672JQE9_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Salarias fasciatus GN=BCL2L10 (length=194 residues).
MSCGLRRETLALAEDYLSLRCRSPCPAPPPPSESAAAMRHMAQDLEKQHQARFQSLAQTFLRQCGPDRCVSLRQVMEEIV
GDGHLNWGRVVSIFTFAGVVARLMLEQKDVTKGLDPGTGQELGQETVNCRALAETIAEYFGGEKKDWMLENDGWEGFCAY
ARTARQASLDSSMKTALFAAAGVGLAGLTFLLVR
© 1998-2020Legal notice