Dataset for protein Bfl1 of organism Rhinolophus ferrumequinum

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A671FLY8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BCL2A1 (length=245 residues).
MPAQEPGSSSAQLRSEVPGREAPISDVSRNSTGPTSHCESHPARLGTLASDFLSPFPVNKLKTLLSSWQKMTDCEFGYIH
ALAQDYLTYVLQVPQPGTGPSRTSRVLQDIASSVQKEVEKNLKPCLDSFDVMSIDTARTIFNQVMEKEFEDGVINWGRIV
TIFAFEGILIKKLLREQITPDVDTYKDISYFVADFITEHTGEWIRQNGGWENGFVKKFGPKSGWLTFLEVTGKICEMFCL
LKQYC
© 1998-2020Legal notice