Dataset for protein Mcl-1 of organism Pseudonaja textilis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670Z5Q4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pseudonaja textilis GN=MCL-1 (length=184 residues).
CESIRLQQKGNCTLYCGGGGGNLAGRSPSPHLQEMTRQNQDTFVPSLTFCGALPKVLPSLLNSGMLRKVQIDKADDLKLM
SEVATQVFNDGITNWGRIVTLISFGAFVAKHLKSINQESGISTLAEIITEVLVTEKREWLLHHNAWEGFVKFFHVEDLEG
SIRNILVAFAGVAGLGASLAYLIR
© 1998-2020Legal notice