Dataset for protein Mcl-1 of organism Podarcis muralis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A670K3Y6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Podarcis muralis GN=MCL-1 (length=331 residues).
MFNKKSVVLYCGGAPSMAPATPVSPGAGGGGSSSGAPTASAAAAAVFTANGRSEGAGPFSPRIGRGWGASVFPEGPLPRI
GSGAPLAGPLARIGPFEVAPRALIGSPAAAAVGGGAARPLALALPEGELDGCDDEAEAQAAQAGDLPSPTPSLESIPSAQ
GDDDDAAVTLELVSRYLREEAAASPGAAQALETLRRVGDNILDKHQLAFQGMLRKIEIKKEDDLKTVSEVAKHLFSDGIT
NWGRIVTLISFGAFVAKHLKRINQESAIGRLAELITEVLVTDKREWILNNNAWEGFVNFFHVEDVEGSIRSVLMAFAGVA
GIGAGLAYMIR
© 1998-2020Legal notice