Dataset for protein Mcl-1 of organism Pelusios castaneus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C8RUG9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pelusios castaneus GN=MCL-1 (length=326 residues).
MLALKRNAVIGLNIYCGGGPALAPSSPASASGGGAPPAPTGPSSTEGVRPATLIGGDPWGPNGPSEGARALIGQEPQEGP
RALIGSPAPSPVAGTPRPDSLCFPEEELDGCDPEPERMGPADGSLPSTPPDEEDDGGPDGLYQDSLELISRYLREAAEPG
SKRLKGLLGEPRRPGGAGPAAVEKALETLRRVGDGVIQKHQIAFQGMLRKLDIKNEEDLKSVSAVATHVFSDGITNWGRI
VTLISFGAFVAKHLRSINQENCINTLAGIITDVLVTDKREWLVNQRGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGAS
LAYMMR
© 1998-2022Legal notice