Dataset for protein Bfl1 of organism Pelusios castaneus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C8SUC3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pelusios castaneus GN=BCL2A1 (length=180 residues).
MESSEYRYVYYLVQDYLKYILQEPHLGPAPSRVAHVLRNTASFLQKENEETLKPCLDTLVITSVDAARRIFIKVMDEEFA
DGNTNWGRILTIFMFGGILSKRLQEHRVQLTEDNKEQISYFITDYIINNKAEWIEANGGWVSFTCSCSISLLVNHCYELE
ALHTSHVWRFLCLLLSVKPA
© 1998-2022Legal notice