Dataset for protein Unclassified of organism Papio anubis

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A2I3N7L6_uncBCL2A1-02 Putative BCL2-related protein A1 protein OS=[Eukaryota] Papio anubis (length=76 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFAILLTRKDTPYCETGLIFLTLKKTTANTYFYF
>gnl|bcl2dbpro|A0A2I3N7L6_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Papio anubis (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKLEPKSGWMTFLEV
TGKICEMLSLLKQYC
© 1998-2022Legal notice