Dataset for protein Bcl-2 of organism Otus sunia

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C8ANG9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Otus sunia GN=BCL-2 (length=243 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPPAAAAAVAAAAAAAGTSSDHTGLVSPHPEPPGSAA
ASHAPPAEGLRPAPQVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGV
MCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPFFDFSWISLKTILSLVLVGACITLGAYL
GHK
© 1998-2022Legal notice