Dataset for protein Unclassified of organism Oreochromis niloticus

[Download (right click)]

11 sequence(s)

>gnl|bcl2dbpro|A0A669B079_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus (length=184 residues).
MLHNIPEPSLCVTSHHHKLISPPMFLCCLWRTATECTLKTCNCNNHTHVHTGMLSLQTTAAEVPMVTGVARALFSDGIIN
WGRVVSLVAYGTVLLRASKSTLGPECAYEIGVSIAAYITDNHMDWLVGSDGWDGFVHTFDRVHQRPWLSTQGKLFVFGVG
LGLLSKQGKLLLLGVGLGLLSVLL
>gnl|bcl2dbpro|A0A669B428_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis niloticus (length=338 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQRDSVFSCSWPSIKTVFG
LAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A669B428_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis niloticus (length=358 residues).
MSSEEGFSSAITDWLFINTWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
KQGAFITLVARDEKLLQAKKEVEKFAINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVE
VDRFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVA
YPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQI
VTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAANKRE
>gnl|bcl2dbpro|A0A669B428_uncBCL2-03 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis niloticus (length=186 residues).
MSSEEGFSSAITDWLFINTWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
KQGAFITLVARDEVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKIVTMGLFRTIALF
YLGSFDSIVRRCMIQREQSKAANKRE
>gnl|bcl2dbpro|A0A669B428_uncBCL2-04 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis niloticus (length=297 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPDQVAKIIVRDAIVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAANKRE
>gnl|bcl2dbpro|A0A669BN75_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus (length=173 residues).
MRGHSAAAEQKPGGVACPWRTATECTLKTCNCNNHTHVHTGMLSLQTTAAEVPMVTGVAHALFSDGIINWGRVVSLVAYG
TVLLRASKSTLGPECAYEIGVSIAAYITDNHMDWLVGSDGWDGFVHTFDRVHQRPWLSTQGKLFVFGVGLGLLSKQGKLL
LLGVGLGLLSVLL
>gnl|bcl2dbpro|A0A669BV66_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Oreochromis niloticus (length=137 residues).
SLLLDYMYYYKCLLCDLMQCMLSLQTTAADVPTVTAGVARALFSDGIINWGRIVSLVAYGTVLLQASKSTLGPECAYGIG
VSIAAYITENHMDWLVGTDGWDGFVHTFDQVHQWPWLSTQGKLFVFGVGLGLLSVLL
>gnl|bcl2dbpro|A0A669CH56_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus (length=225 residues).
MEHLPWTRDKHRCAACDLVLHSFVVGDTFVGEHIYHIHKEGKRCPYIDARYDRDEILYELGRQRSRRGQLAFPSRVLTAE
RGYSSVAGLERCLVCGVTTIQEKYLPSLGHDAWCSVPSLNVTSHHTTRALFSDGIINWGRIVSLVAYGTVLLQASKSTLW
PECAYGIGVSIAAYITDNHMDWLVGTDGWDGFVDTFDRVHQRPWLSTQGKLFVFGVGLGLLSVLL
>gnl|bcl2dbpro|A0A669F4C0_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus (length=199 residues).
MRCLRFGSAQLCGRRHLCGRAHLFHIQPRQALSVYRREIRQRRDTLRTRTATFPERTTRLTESRTHTTECTLKTCNCNNH
THVHTGMLSLQTTAAEVPMVTGVARALFSDGIINWGRVVSLVAYGTVLLRASKSTLGPECAYEIGVSIAAYITDNHMDWL
VGSDGWSACWFCTSAPPEFVHFCRLPLFLIPSLAAIRIT
>gnl|bcl2dbpro|I3KLB3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis niloticus (length=200 residues).
GAMAAAYNSRDLVEDFLRYKLLGRGVAWPQRRANDVRAPRPDPPVAPPRLQAVLRSASDELERLHGNELSAQVTVLRLRG
NGGGAARRRHLTAIREELFRDGVNWGRIVTMMELGGALSAAAAKSGDEGQVDDIASWMEESLDSPSLRRWIHDNGGWDAF
VELYESRPTDSFWSLRTVLGLVVLGAVGVILGFLFSQKQN
>gnl|bcl2dbpro|I3KWT0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Oreochromis niloticus (length=197 residues).
MQCSNRELVEFFISYKLSQKNHPTSLLRPTNGGQRTERDLAQSLPAYNGIEALKSALLDSGEQFGFLFTQSFRDVASHLS
ITPDTAQQCFESVMEELFRDGINWGRIIGLFVFGSAMCLDCIDSNMSELVPDIADWMTAYLDDHISLWIQRNGGWDRFTE
IFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
© 1998-2022Legal notice