Dataset for protein Unclassified of organism Oreochromis niloticus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|I3KWT0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Oreochromis niloticus (length=197 residues).
MQCSNRELVEFFISYKLSQKNHPTSLLRPTNGGQRTERDLAQSLPAYNGIEALKSALLDSGEQFGFLFTQSFRDVASHLS
ITPDTAQQCFESVMEELFRDGINWGRIIGLFVFGSAMCLDCIDSNMSELVPDIADWMTAYLDDHISLWIQRNGGWDRFTE
IFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
© 1998-2020Legal notice