Dataset for protein Mcl-1 of organism Oreochromis niloticus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|I3JHR5_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus GN=MCL-1 (length=323 residues).
MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKRPNNLGVTSTNGYTTKAIRDR
EEDGSLPSTPEYHLDGESDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESTVRNTLMAFAGFAGIGATLALLIRTNTHSGLRKKWRVSRHGDDPQQASPNLLLWLMLSTTQVTPVVNCEEHT
GRQ
>gnl|bcl2dbpro|I3JHR5_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus GN=MCL-1 (length=294 residues).
MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKRPNNLGVTSTNGYTTKAIRDR
EEDGSLPSTPEYHLDGESDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESTTREVEWTKGKMFQITLFNSQRSIFAKRCHNKKEKDIFFPFLLVFF
>gnl|bcl2dbpro|I3JHR5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus GN=MCL-1 (length=278 residues).
MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKRPNNLGVTSTNGYTTKAIRDR
EEDGSLPSTPEYHLDGESDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESTVRNTLMAFAGFAGIGATLALLIRFWDALL
>gnl|bcl2dbpro|I3KXG5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus GN=MCL-1 (length=227 residues).
MFSLNCCLSEWCPNNDVGFIDNWETLCRKPGLVRRDGIHPTLDGAALISRNLEDGSLPSTPEETKLIIHSFLGDFTGLSQ
PQRKETKALKMMKRVVADVLEKHRYAYNGMINKLSLDEREEDMSFVAKSLFGDHTTNWGRIVSFVAFGAVVSQHLKEKGR
DNCVVLVSQEISAYLLSEQRDWIIKNNAWDGFVAFVRVADPESIVRNTLMAFAGFACIGATLALLIR
© 1998-2020Legal notice