Dataset for protein Bcl-xL of organism Neovison vison

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C7BPR9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Neovison vison GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
ALVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C7BPR9_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Neovison vison GN=BCL2L1 (length=221 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
ALVSRIATWMATYLNDHLEPWIQENGGWVRTGLFYPEFLAHGLRLGKGLASICSVNMKGYY
© 1998-2022Legal notice