Dataset for protein Unclassified of organism Neogobius melanostomus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C6SIN0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Neogobius melanostomus (length=196 residues).
MSLNRELVVFYITYKLSQRNFPWTTWTELRGGVRTEEGAGLRGGVRTEEGSDTHTNGSVNGDLEAVKEALQDAANEFELR
FSRAFSDLHQQLHITPATAYRSFESVMDEVFRDGCVEKEMSPLVARIAEWMTLYLDNHIQDWITAQGGWARFSQIYGQDA
AAESRRSQESLKKWLWAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A8C6WWR3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Neogobius melanostomus (length=210 residues).
MYICHKLSKRGYAWGFHEDTEDEDDAANNGSIVASSPALVNRRCRGERLYTRSAQSDPYAAIHRVLREAGDELEKLYQPD
FTEMSRQLYLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASKEDMSSQVDNIADWMTEYLNGPLGSWIQ
DNGGWEAFVELYDRQRESVFSCSWPSIKTVFGLAAIGAASLTIGAYLSQK
© 1998-2022Legal notice