Dataset for protein Unclassified of organism Marmota marmota marmota

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C5YZ00_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Marmota marmota marmota (length=172 residues).
MSQRNVELVINFLSYTLFQKGYSWSQFSHEEENHLQGPERAESEEGPSNATNSNPSRHQGDSPMVSGAAGHNRSLDAPNV
VPMVAVKQALREAGDNLYQQAFHDLTAELRLTPQTAHHTFEQDHCCWDTFVKHHVNNAAVNSWMRQESFNYYFLMGMTVA
GVVLLGWLFSWK
>gnl|bcl2dbpro|A0A8C6A7L3_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Marmota marmota marmota (length=149 residues).
MWKRTTLKAQEGLNQRWSPPVPSMATHPGICTEGAHQTFEQVVKGLFQDAVSWGRIVAFFSFGGTLCVESIDKEMQALES
QIPSWMATYLNDHLETWVQDNGGWDTFVELHGNNVAVNSWKGQEHFNHCFLMGMTVAGVVLLGWLFSWK
>gnl|bcl2dbpro|A0A8C6EYW0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Marmota marmota marmota (length=170 residues).
MQLPHTSPNSVINDDIFSLAMHTLRWLSPAEENHTLKPIRGYWDAINGNPSWHLVDSPMESGAPGHNRSLDAPEAIPMAA
VKQVLREAGEKSELQYQQAFSDMASKLHLTLETAHQTFEQDNGGWDTFVELHGNNVAVKSWKGQEHFNLCFLMGMIVAGV
VLLGWLFSRR
© 1998-2022Legal notice