Dataset for protein Bcl2l10 of organism Marmota marmota marmota

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6EVC2_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2L10 (length=183 residues).
MADLLQERTAELLTDYLEYCAREPGTPEPPPSTPEAALLRSAAARLQQQYEPFFSLYRGHPGNRVELMAQMAEAVLSDNQ
ALNWGRVVMLVTFAGTLLERKPQDTHGPHTRDQAALDCQRLVDLLCAQLVGRHRAWLEAQGGWDGFCDFFRTPLPLTFWR
NLLVQIFMSCLLATIFIYFCKRF
© 1998-2022Legal notice