Dataset for protein Bfl1 of organism Laticauda laticaudata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5SDG4_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Laticauda laticaudata GN=BCL2A1 (length=173 residues).
MESYNFLYVNTLVQDYLKYICQEAQLAAAPNKVAEVLRKAGSSAQKEVEGNLRPYVDSLGIHSIEEAGNIFNQVMENEFA
DGKINWGRILTIFLFGGILAKKLQGPLAKENLKQISYFITDYIVSTKGKWISENGGWDNGFITKFEDRNSWVSLSTLKTK
ILAVFSVFNQYHS
© 1998-2022Legal notice