Dataset for protein Unclassified of organism Hippocampus comes

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2YEL9_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Hippocampus comes (length=200 residues).
MSSCGLWNESLAIAEDYIGLCLTADPSEAPLPPSEAAATMRRMGRHAESLYEATFQNLVQTFVRGCWPDLCSGLRRVMQE
MVSDGFLNWGRVVSVFAFTGVLARRLLEDNEEEETTTTTTKLRLDLSDWPQICRKLAETIADFLIEEKKEWMLENNGWEG
FCKWCSSSSSRQSSQDAYLKTALLAAAGVGLAGLTFLLAR
>gnl|bcl2dbpro|A0A3Q2YX57_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hippocampus comes (length=233 residues).
MPESIRLQIFKIGLVDAFISPPKTVVQESTAPQLQEMELRSDNSDMDEGAQPLPELQTPPGQGILDSDTRRLISRFLSDF
TGLSTAAWIQSKAQSTMKRVVMRLVDKHRILFNNSINELSLDEIGLDIVSQVPQTEFANGNINWGRIASLLAFCAVLSQA
LKENQQESCVELVAQEVSTYLLSHQRTWLVQHNGWDGFAEFFKEDDLESSVRNVLLGFVGLVSITAALRCLIR
© 1998-2020Legal notice