Dataset for protein Unclassified of organism Gouania willdenowi

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C5GAN3_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gouania willdenowi (length=185 residues).
METTENSRCHSGVAISNNEIDWMGFGNRHVNSFYSANVRVYFNLHFVLTGMVNILSQMNCCENMTFVSIVGRDVFADRTN
WGRIASLVAFGAVLCQHMKERGRTNCVELACQTISTYLLTEQREWLMNNNSWDGSVDFFRVADPESTVRNILQAFAGFAG
IVATLAFLIKLIWTLKKLTFGLLFC
>gnl|bcl2dbpro|A0A8C5NH03_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Gouania willdenowi (length=190 residues).
MSCGLRSETLTLAEDYLSLCSSPHSAPPPPSESAAAMRRMAGDLESQHQARFHSLVQTFLRQCGPDLCTSLRKVMEEMVG
DGHLNWGRVVSLFTFSGVLARQLQEERAETLGLDPGLWQEAGQGPKELAETIAEYLGVEKKDWLLENKGWEGFCAYSRRT
TEVNHDLSMKTALFAAAGVGIAGLTFLLVR
© 1998-2022Legal notice