Dataset for protein Mcl-1 of organism Fundulus heteroclitus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2P7X9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Fundulus heteroclitus GN=MCL-1 (length=297 residues).
MSKAPTSTQLVNCLISQNGVGDGQPHYRPGLQLPEVEMSSSSEDLRWDCSKRPKNLRVMARNGFAVKSIQENRDDGSLPS
TPEMQADSEAAGCGSHAGQEALDSDTTELISGFLRDFTGLSGHRWYTKKSLSTMKRVVEDLLSKHRYAYTGMIRKLNLDQ
KSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQHLKESGRSHCVDLVSREISTYLLTNQRDWLAKNNSWDGFVEF
FKVEDTESTVRNTLMAFVGVAGIGAGLAFLIRNSIKISFIGQDCSWAFTSPPTFPGL
>gnl|bcl2dbpro|A0A3Q2P7X9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Fundulus heteroclitus GN=MCL-1 (length=272 residues).
MSKAPTSTQLVNCLISQNGVGDGQPHYRPGLQLPEVEMSSSSEDLRWDCSKRPKNLRVMARNGFAVKSIQENRDDGSLPS
TPEMQADSEAAGCGSHAGQEALDSDTTELISGFLRDFTGLSGHRWYTKKSLSTMKRVVEDLLSKHRYAYTGMIRKLNLDQ
KSDDMGFVTSVAVSLFSDGTTNWGRIASLVAFGAVLCQHLKESGRSHCVDLVSREISTYLLTNQRDWLAKNNSWDGFVEF
FKVEDTESTVRNTLMAFVGVAGIGAGLAFLIR
© 1998-2020Legal notice