Dataset for protein BCL-2-like of organism Ficedula albicollis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A803V184_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ficedula albicollis GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRTMASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKSEWIDANGGWENGFLTKFERRSLLSFSKIT
ALFIAVVSLFREYY
>gnl|bcl2dbpro|A0A803VLI1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ficedula albicollis GN=BCL2L1 (length=209 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAPTSHIVNGASVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVDPSPVAATL
>gnl|bcl2dbpro|A0A803VR88_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ficedula albicollis GN=BCL-2 (length=239 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEHRAPLPPGLSAPAAAAVAAAAGTSSDHTGPVSPHPEPPGSAAASPA
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A803VR88_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ficedula albicollis GN=BCL-2 (length=229 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEHRAPLPPGLSAPAAAAVAAAAGTSSDHTGPVSPHPEPPGSAAASPA
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDRSCFAKYFFVAAQLWIPALDTNTRAIHASPLEK
© 1998-2022Legal notice