Dataset for protein Bcl-xL of organism Ficedula albicollis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A803VLI1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ficedula albicollis GN=BCL2L1 (length=209 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAPTSHIVNGASVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVDPSPVAATL
© 1998-2022Legal notice