Dataset for protein Bfl1 of organism Felis catus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|M3WHW2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Felis catus GN=BCL2A1 (length=174 residues).
MADGEFGYVLTLARDYTEHVLQGPQPGSHPSRVSQVLQDVAFSVQGEVEKKLKPCLDKFHVVSVDTARTIFHQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWENGFVRKFEPKSGWLTFLEVT
GKICKVLSLLKNYY
© 1998-2020Legal notice