Dataset for protein Unclassified of organism Equus caballus

[Download (right click)]

5 sequence(s)

>gnl|bcl2dbpro|A0A5F5PUY3_uncBCL2A1-04 Putative BCL2-related protein A1 protein OS=[Eukaryota] Equus caballus (length=174 residues).
MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFE
DGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWENGFVKKFEPKSGWLTFLEV
TGKMCEILFLKQYY
>gnl|bcl2dbpro|A0A5F5PUY3_uncBCL2A1-03 Putative BCL2-related protein A1 protein OS=[Eukaryota] Equus caballus (length=211 residues).
MTDCILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVIAHSQYQKSKRISIFLSMQDEIETEEIIRDIF
QQGKTCFIPRYQFNSNHMDMVKLASPEEILSLPKTSWNIHQPGEEEVREEALSTGGLDLILMPGLGFDKHGNRLGRGKGY
YDTYLKRCLQHQEVKPYTLALAFKEQICVQVPVDENDMKVDEVLYEDSSAS
>gnl|bcl2dbpro|A0A5F5PUY3_uncBCL2A1-02 Putative BCL2-related protein A1 protein OS=[Eukaryota] Equus caballus (length=230 residues).
MEKQFEDGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVIAHSQYQKSKRIS
IFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNSNHMDMVKLASPEEILSLPKTSWNIHQPGEEEVREEALSTGGLDLIL
MPGLGFDKHGNRLGRGKGYYDTYLKRCLQHQEVKPYTLALAFKEQICVQVPVDENDMKVDEVLYEDSSAS
>gnl|bcl2dbpro|A0A5F5PUY3_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Equus caballus (length=231 residues).
MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFE
DGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVIAHSQYQKSKRISIFLSMQ
DEIETEEIIRDIFQQGKTCFIPRYQFNSNHMDMVKLASPEEILSLPKTSWNIHQPGEEEVREEALSTAAWR
>gnl|bcl2dbpro|A0A5F5PUY3_uncBCL2A1-05 Putative BCL2-related protein A1 protein OS=[Eukaryota] Equus caballus (length=203 residues).
MAAAAVSGAKRRLRAELKQRLRAMSAEERLRQSRLLTQKVIAHSQYQKSKRISIFLSMQDEIETEEIIRDIFQQGKTCFI
PRYQFNSNHMDMVKLASPEEILSLPKTSWNIHQPGEEEVREEALSTGGLDLILMPGLGFDKHGNRLGRGKGYYDTYLKRC
LQHQEVKPYTLALAFKEQICVQVPVDENDMKVDEVLYEDSSAS
© 1998-2020Legal notice