Dataset for protein Bcl-2 of organism Equus asinus asinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4L1K6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Equus asinus asinus GN=BCL-2 (length=232 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPLGATPVPGIFSSQPGRTPAPARTSPLLPPAAPAGAAGPALS
PVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
© 1998-2022Legal notice