Dataset for protein Bcl-xL of organism Epinephelus coioides

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A219P0Y3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Epinephelus coioides GN=BCL2L1 (length=232 residues).
MCQNRELVVCYIKYKLTQRNYPLNHMGLIEPPNRTDGGEAGLGEEQRVATHANGTFNGMSPGTPPASPLRQQQLPSTTSL
DAVKEALRDSANEFELRYARAFSDLHHQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLV
GRIIEWKTRYLDNHIQPWIQSQRGWERFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A510BW31_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Epinephelus coioides GN=BCL2L1 (length=221 residues).
MSYSNRELVEFFVSYKLSQRNHPTSLLRPEGAEGRTERDKASSAASNGLLVNSRNGGSQPGTSSPPHGDIEAVKAALRDS
ADEFELLFTQSFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRVVGLFAFGGVLCVECVEKDMSELVSRITDWMTTY
LDEHINPWIQTQGGWDCFAEIFGQNSAAEARRSQESLRRWLLVGVALLMGVLVGVVIAKNH
© 1998-2021Legal notice