Dataset for protein Bcl-xL of organism Echeneis naucrates

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A665VM40_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Echeneis naucrates GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKYKLSQRNYPLNHMEFNESLHRTDGGGAGLVEEQRVATHSNGTFNGTSSGTRSESPQGQQHLASMTSL
DAVKEALLDSANEFELRYSRAFSDLHNQLHITPATAYISFENVMDEVFRDGVNWGRIIGLFVFGGALCVECVEKEMSPLV
VRIIEWMTVYLDNNIQPWIQGQGGWEHFAELFGHDAAAESRRSQESFTKWLLAGMTLLTGVVVGSLIARKRL
>gnl|bcl2dbpro|A0A665VSD7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Echeneis naucrates GN=BCL2L1 (length=217 residues).
MSYSNRELVEFFIHSKLPLASLLRPEDAGGQTEGDKANSAARNGLPVISGSMLSYTRTPPPPPCDIEAVKEALRDSTDEF
EFLFRQAFSDLSSQLDITSDTVYQSFETVMDEVFKDGINWGRIVALFAFGGELCVECVEKNMSEMVPSIAEWMTIYLDLH
IRPWIETQGGWDCFAEIFGQNSAATARRSQEAARRWLLVGVALLTGVLMGVLIAKKQ
© 1998-2020Legal notice