Dataset for protein BCL-2-like of organism Dromaius novaehollandiae

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C4JDK2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Dromaius novaehollandiae GN=BCL2L1 (length=210 residues).
MSSSNRELVIDFVSYKLSQKDYSWSQLEEEDENRTDFAVEAGMAGVLNGSPSWHPPASHVVNGAAVHRSSLEVHETVQAA
DVRQALREAGDEFELRYQRAFSDLTSQLHITPATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVEKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWRCMGLCPWEVYGLQMSEFSSCFCFGI
>gnl|bcl2dbpro|A0A8C4JDK2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Dromaius novaehollandiae GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQKDYSWSQLEEEDENRTDFAVEAGMAGVLNGSPSWHPPASHVVNGAAVHRSSLEVHETVQAA
DVRQALREAGDEFELRYQRAFSDLTSQLHITPATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVEKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAEIRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C4K2K9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Dromaius novaehollandiae GN=MCL-1 (length=178 residues).
PVGRPLGGVCGPGLCGALEVGGHRLCPAAAGSSGGWGRPGPPPALGAGARLQIASPAGMLRKLDIQKEEDLQSVCEVAAH
VFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLVSQGGWEGFVDFFRVEDLEGSIRNVL
MAFAGVAGLGASLAYMIR
© 1998-2022Legal notice