Dataset for protein Mcl-1 of organism Dipodomys ordii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1S3F3I1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Dipodomys ordii GN=MCL-1 (length=349 residues).
MFGLRRNAVIGLNFYCGGAGLGAGSGAAAAPGGRLLTAEEASARREAGGGEAGAGIGGSAGASPSTTLAPDARRVARPAP
IGAEVPDVTGTPTKRVFFAPTHRAPTPDEMEAAAAGAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASKSSRTDGSLP
STPPPAEEEDDELYRQSLEIICRYLREQATGAKDAKPLGGAGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV
EDLEGSIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2020Legal notice