Dataset for protein Mcl-1 of organism Cyclopterus lumpus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C2Z1X1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyclopterus lumpus GN=MCL-1 (length=278 residues).
MNIISTKRAAFKMTGVMGCIILPQNGVVERPVHYGSGESSPLVAMGSAKDSHNGNAASNDAPKRPKILGYASKMIQGADD
HDGGSLPCTPEPDSEIDVSDSQAGAEVLENDTRQLMGRFLGDFTGLSKSQWHESRELSTMKRVVKDVLEKHRYAYNGMIN
KLSLDDRSDDASFVREVAKSLFADGTTNWGRIVSLVAFGAVVCQYLKEKNRGNCVELVGQEISTYLLSDQRDWLVKNNAW
EGFVEFFRVVDPESTVRNTLMAVAGFASIGATLALLIR
© 1998-2022Legal notice