Dataset for protein Mcl-1 of organism Cricetulus griseus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C2MG79_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cricetulus griseus GN=MCL-1 (length=340 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLTAEEAKARREGGGEAGLLPGARVAVRPPPVGAEDPDVTASAERRLLR
SPGLLAVPPEEMAAPASASSSTAAAAAIMSPEEELDGCEPEALGKRPAVLPLLERVSSEAAKNPGAAGSLPSTPPSAEEE
EDELYRQSLEIISRYLREQAAGVKDAKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKMDIKNEDDVKSFSRVM
VHVFKDGITNWGRIVTLISFGAYVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRN
VLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C2MG79_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cricetulus griseus GN=MCL-1 (length=292 residues).
MFGLRRNAVIGLNLYCGGDPDVTASAERRLLRSPGLLAVPPEEMAAPASASSSTAAAAAIMSPEEELDGCEPEALGKRPA
VLPLLERVSSEAAKNPGAAGSLPSTPPSAEEEEDELYRQSLEIISRYLREQAAGVKDAKPLGEAGAAGRRALETLRRVGD
GVQRNHETAFQGMLRKMDIKNEDDVKSFSRVMVHVFKDGITNWGRIVTLISFGAYVAKHLKSINQESCIEPLAESITDVL
VRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2022Legal notice