Dataset for protein Bfl1 of organism Cricetulus griseus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3L7HT14_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2A1 (length=333 residues).
MITPSLSSHLWLSCLFDWTWQLQSALPRTMTDCEFMYIHSLAEDYLQYVLKVPTFESAPSKTSRVLQRVASSVQKEVEKN
LKLYLDDFDVRSIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGLDVGAYKQVSNFVAEFIMNNTA
EWIRQNGGWVIAHSQYQNSKRISIFLSMQDEIETEEIIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEISLLPKTSWN
IHQPAEGDAREEALSTGGLDLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVKPYTLALAFKEQICPQVPVDEHDM
KVDEVLYEDCPAS
>gnl|bcl2dbpro|A0A3L7HT14_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2A1 (length=236 residues).
MACAPMLVHRGHAPSLPTASEGDGRGRGGTCHVMAAVAASSAKRSLRAELKQRLRALSAEERLRQSHLLTQKVIAHSQYQ
NSKRISIFLSMQDEIETEEIIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEISLLPKTSWNIHQPAEGDAREEALSTG
GLDLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVKPYTLALAFKEQICPQVPVDEHDMKVDEVLYEDCPAS
>gnl|bcl2dbpro|A0A3L7HT14_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2A1 (length=232 residues).
MITPSLSSHLWLSCLFDWTWQLQSALPRTMTDCEFMYIHSLAEDYLQYVLKVPTFESAPSKTSRVLQRVASSVQKEVEKN
LKLYLDDFDVRSIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGLDVGAYKQVSNFVAEFIMNNTA
EWIRQNGGWEDGFMKKFEPKSGWVTFLETIGQIWEMLFSPQATLLAREDPGSFDNGDHHLVLPFANNSADRT
© 1998-2020Legal notice